SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020570 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020570
Domain Number 1 Region: 224-533
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.78e-115
Family Transglutaminase core 0.0000000167
Further Details:      
 
Domain Number 2 Region: 75-221
Classification Level Classification E-value
Superfamily E set domains 2.03e-44
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 659-758
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 
Domain Number 4 Region: 547-658
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.05e-28
Family Transglutaminase, two C-terminal domains 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020570   Gene: ENSOARG00000019146   Transcript: ENSOART00000020853
Sequence length 786
Comment pep:known_by_projection chromosome:Oar_v3.1:7:20524488:20538003:1 gene:ENSOARG00000019146 transcript:ENSOART00000020853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMWGSSLGFGRWGGNPWRPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRNSRRPGS
RGSAVNAAGDGTIRDGMLVVTGMDLLSSRSDQNRREHHTDEFEYDELILRRGQPFHMVLF
LSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTS
PNAIIGKFQFTVRTRCKAGEFQLPFDPRNEIYILFNPWCPDTEDIVYVDHEDWRQEYVLN
ESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRRDPVSVSRVISAMVN
SLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRC
LGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPS
GFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDD
GSFKIVYVEEKAIGSLIITKAIGSNMREDVTHTYKHPEGSEAERKAVETAAAHGSKPNVY
ATRDSTEDVAMQVEAQGTVMGQDLTVCVVLTNRGSSPRTVKLHLYLSVTFYTGVTGSVFK
ESKKEVVLAPGASERVTMPVAYKEYRAQLVDQGAMLLNVSGHVKENGQVLAKQHTFRLRT
PDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAGGGGAFSDIRGSGRSRETIPM
ASRGGA
Download sequence
Identical sequences W5QCX2
ENSOARP00000020570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]