SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020610 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020610
Domain Number 1 Region: 770-873
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-20
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 162-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 611-766
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020610   Gene: ENSOARG00000019187   Transcript: ENSOART00000020893
Sequence length 951
Comment pep:known_by_projection chromosome:Oar_v3.1:3:218014774:218132516:-1 gene:ENSOARG00000019187 transcript:ENSOART00000020893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDYYNGGCVH
ECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECRCHGGFFL
SDNQHTCIHRSDEGMNCMNKDHGCAHICRETPKGGVACDCDCGPGFDLAQNQKDCTLTCN
YGNGGCQHSCEDTDTGPTCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSC
PVGFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQEAEKK
NRYKSCSMVVCLSAASSICSVGPPPYTHTHTCQGFDAGKGGSSDDDPRGAGAGWDSGFPC
SEMVKMDGRHGGETGRCLSRAKASPPAQLSCGKVGGVESCSLACPGHTLFTPDSDNSYSL
SCGVPSLQGKALQKRNVTSSSAGPSCSGAPTALIRQKARFKIRDAKCPEAGSQPRRPRGS
CCWWPLPCPENCHLTFVTLKCDSSKKRRRGRKSPSKEVTHITAEFEVETKVEEASDTCEA
ACVRGGGEMRLPLSIQPSNPRPQRAGRKSKVSKAPAKGHGGCGASNQLQGARSLPPAVAC
GPGTYFSGEPGQCVPCLPGTYQDGLSQLSCTPCPSSDGLRGPPSEEGRAVGGRQCSPGSF
STDGFRPCQACPMGTYQPEPGRTGCFPCGGGLLTKHEGSASFQDCEAKVHCSPGHHYNTT
SHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESP
NYPGDYPASPWCVWHISPPPKRRILVVVPEIFLPIEDECGDVLVMRKSASPTSITTYETC
QTYERPRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEIL
KDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences W5QD12
ENSOARP00000020610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]