SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020617 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020617
Domain Number 1 Region: 645-873
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.14e-85
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 334-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000366
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 73-151
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000418
Family SEA domain 0.0058
Further Details:      
 
Domain Number 4 Region: 483-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 232-316
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000811
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 6 Region: 448-480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020617
Domain Number - Region: 519-547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0157
Family LDL receptor-like module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020617   Gene: ENSOARG00000019191   Transcript: ENSOART00000020900
Sequence length 874
Comment pep:known_by_projection chromosome:Oar_v3.1:3:180305932:180339083:-1 gene:ENSOARG00000019191 transcript:ENSOART00000020900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAKAPQAAGGQGDGGDGEEAEPEGMFTAPKDTKRKVRDCLRLAPLWLALVMLASVGLL
LWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLARRESSAFRSETAKAQKMLKELIASTPL
GTYYNSSAVYSFGEGPFTCFFWFILQIPEHRRPMLSPDVVRALLAEELLSAANSSVPAPY
RTEYEVDPEGLVILEASVKDIVALNSTLGCYRYSYVGQGQVLRLKGPDTLASSCLWHLQG
PQDLMLKLRLEWKLADCRDRLAMYDAAGPLERRLITSVYGCSRQEPVVEVLASGAIMAVV
WKKGLHSYYDPFVLSVQPVTFQACEVNLTLEGRLEPQGVLSTPYFPSYYSPSTHCSWHLT
VPSLDYGLALWFDAYALRRQKYDMPCTQGQWTIQNRRLCGLRTLQPYAERIPVVASAGIT
INFTSQISLTGPGVQVHYSLYNQSDPCPGEFLCSVNGLCVPTCDGVKDCPNGLDERNCVC
RATFQCQEDSTCIPLSRVCDRQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNPQC
DGHPDCDRLGWAGHPPPAGPTSMGGREVPTLGGWRESSLSVHLSLFTPPLAPHGGPAHLP
LSRSLILFPWPPLCLSSLLFHASPSVPVSHWFSPAPAPAPPSTPAPAQGEWPWQASLQVR
GRHICGGALIADRWVITAAHCFQEESWASPALWTVFLGKVWQSSRWPGEVSFKVSRLLLH
PYHEEDSHDYDVALLQLDHPVVRSAAVQPICLPARSHFFEPGLHCWITGWGALREGGPTS
NGLQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRNGKKDACQGDSGGPLVCKEPSGRWFL
AGLVSWGLGCGRPNYFGVYTRITGVISWIQQVLT
Download sequence
Identical sequences W5QD19
ENSOARP00000020617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]