SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020650 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020650
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-48
Family C-type lysozyme 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020650   Gene: ENSOARG00000019223   Transcript: ENSOART00000020933
Sequence length 142
Comment pep:known chromosome:Oar_v3.1:3:137390403:137392415:1 gene:ENSOARG00000019223 transcript:ENSOART00000020933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSFVSLLLVGILFHATQAEQLTKCEVFQKLKDLKDYGGVSLPEWVCTAFHTSGYDTQAI
VQNNDSTEYGLFQINNKIWCKDDQNPHSRNICNISCDKFLDDDLTDDIVCAKKILDKVGI
NYWLAHKALCSEKLDQWLCEKL
Download sequence
Identical sequences A5JSS8 P00712 W5QD52
NP_001272564.1.57651 ENSOARP00000020650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]