SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020665 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020665
Domain Number 1 Region: 587-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-81
Family Eukaryotic proteases 0.0000627
Further Details:      
 
Domain Number 2 Region: 88-217
Classification Level Classification E-value
Superfamily SEA domain 2.75e-22
Family SEA domain 0.0079
Further Details:      
 
Domain Number 3 Region: 232-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000068
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 4 Region: 355-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000497
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 5 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 503-540
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000681
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020665   Gene: ENSOARG00000019238   Transcript: ENSOART00000020949
Sequence length 829
Comment pep:known_by_projection chromosome:Oar_v3.1:1:175180430:175233431:1 gene:ENSOARG00000019238 transcript:ENSOART00000020949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENRNTSSKAVDVNISNISVQVISAPGKLPGRRPPRKPIAGAKPKKQLKKKAPFWNTQ
NKIVLFTVFLFILAVIAWTLLWLYISKTESRDAFYFAGMFRITNIEFLPEYRQKESREFL
SVAQTVQQVINLVYTTSAFSEFYKQSVVADVSSNNKGGLLVHFWLVFVMPHAKGHIFCED
CVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGSDKGCSQDFYAD
HLSLRYPLEISTTSGRLRCHFKLVAIVGHLIRLSIESVQIEADSCVTNSLTIYDSLLPIR
STILYRICEPIRTLKSFVSTNNLMLVTFKSPQVWRLSGIRAYFEVIPEQKCENTVLVKEI
TGFEGKISSPYYPSYYPPKCKCIWKFQSPLSTLGIALKFHNYSITKKSMKGCDHGWWEIN
EHMYCGSYMDHQTIFRVPSPLVHVQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVTLKPACNASSFRQHSPLICDGFQDCEDGQDEQNCT
HSIPCNDRTFKCGNDVCIRKQNAKCDGNMDCPDRTDEEGCRCTSSSPTLHRIIGGTDTQE
GGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGSRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQTFDYDIALLQLSVAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADNKGSPVLQQAEVELIDQTLCVSTYGIVTSRMFCAGVMSGKKDACRGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences W5QD67
ENSOARP00000020665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]