SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020732 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020732
Domain Number 1 Region: 86-409
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.4e-106
Family Phosphofructokinase 0.000000274
Further Details:      
 
Domain Number 2 Region: 411-822
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.72e-106
Family Phosphofructokinase 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020732   Gene: ENSOARG00000019300   Transcript: ENSOART00000021018
Sequence length 855
Comment pep:known_by_projection chromosome:Oar_v3.1:3:138238132:138280543:-1 gene:ENSOARG00000019300 transcript:ENSOART00000021018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKVEFHLKFFMCVTQSRQLVRTPQRTAEEASTSSMLIQKPPSGTDALESLDTVDDPDTV
EGIPIIENEWIMTHEEHHEAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVF
FVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWGDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKQGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTRAMDERRFDEAMKLRGRSFMNNWEVYKLLAHVRPPKSKQIWSNHIVACTR
WPLGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGS
KLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVI
PATVSNNVPGSDFSVGADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAG
LAAGADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYS
EEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTP
DSGCVLGMRKRALLFQPVTELQEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHA
HLEHITRKRSGEANI
Download sequence
Identical sequences W5QDD4
ENSOARP00000020732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]