SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020812 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020812
Domain Number 1 Region: 296-511
Classification Level Classification E-value
Superfamily SIS domain 0.00000000604
Family mono-SIS domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020812
Domain Number - Region: 80-181
Classification Level Classification E-value
Superfamily SIS domain 0.0207
Family mono-SIS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020812   Gene: ENSOARG00000019373   Transcript: ENSOART00000021098
Sequence length 512
Comment pep:known_by_projection chromosome:Oar_v3.1:3:34409458:34429782:1 gene:ENSOARG00000019373 transcript:ENSOART00000021098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKWFQLVIETPEPGKWELSGYEAALPITAKSNLTRDLDKADAEQTVRLLGQCDAELF
QEEGQVMPTYQLYNESSLTTMEQVAEKVQKVLRVPEDKSLGWGWGLVVLSGGGTSGRMAF
LMSVCFNQLMKGVGQKPTSMLEATGGDCSVVASREGTEDSALEGLRKVAAGKKRAIVIGT
SVGLWAPFGAGQMDYCLDNPDVLPVLVGFNPLSMARNKPISGLWCNSLEVFNHTVNTVSS
LCLGLLCRRSVEREGCSGEKVLGKKSAANILLEALLPAAHKTVDHCSIRTICLLEILQIF
EWASQATYGQSPKIATLMKQASTRYPGEKGQVYLVGWQTLGIIGIMDGVECMHTFGANGT
PVQSFLLEGFSPLFLPQGPHFSFSQEDVLTSILPSLTETDTVLFIFTLDDGLTEVQTLVE
QGKEKTSNIQALAHSTVGQSLPIPLKKPFPSISSITRPLLFFKYEGNFIQKFQYELSTKR
VLNTMIIGAHVLLGQILQNHMLDLLIHNSKLL
Download sequence
Identical sequences W5QDL4
ENSOARP00000020812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]