SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020832 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020832
Domain Number 1 Region: 1314-1422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 616-730
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-33
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 3 Region: 1660-1779
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 4 Region: 452-556
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 1837-1947
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 6 Region: 275-385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 7 Region: 1134-1255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 70-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 9 Region: 967-1076
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 788-909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 11 Region: 2190-2295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 12 Region: 2010-2117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-24
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1482-1597
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-23
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 14 Region: 2568-2636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 2987-3056
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2927-2998
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.78e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2625-2692
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 212-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000103
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 19 Region: 3107-3175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000125
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 2868-2938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 1952-2020
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000836
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 2479-2541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 23 Region: 2359-2425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000175
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 6-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 2296-2369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 1778-1840
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 2808-2862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 28 Region: 2741-2801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 2685-2752
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 30 Region: 736-796
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 1254-1317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000243
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 3039-3101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 33 Region: 1427-1494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000337
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 34 Region: 390-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000361
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 35 Region: 1079-1141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000526
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 36 Region: 2122-2186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 37 Region: 1604-1667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 38 Region: 561-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 2430-2496
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000702
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 40 Region: 3166-3224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000089
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 41 Region: 909-971
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000998
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020832   Gene: ENSOARG00000019388   Transcript: ENSOART00000021118
Sequence length 3465
Comment pep:known_by_projection chromosome:Oar_v3.1:1:8191664:8624214:-1 gene:ENSOARG00000019388 transcript:ENSOART00000021118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSHTCGNPGRLPNGVQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWDFP
LPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDG
YDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRTRGSRAQGPAFFKKQIE
LKSRGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCN
EGYDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAH
CVWIITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVST
NHQMWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGVPAYGRREGSRFRHGDTLQFECQPA
FELVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILA
RPESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQT
DHSTGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETI
TCVLKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPI
KITFDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNHLYLLFSTDKSHSD
IGFQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPN
FQWSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFH
LESGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNIT
FSEYDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSP
LPRCVAECGNSVTGTQGTLLSPNFPVNYSNNHECIYSIQTQPGKGIQLKAKAFELSEGDV
LKVYDGNNNSARLLGVFSRTEMLGVTLNSTSSSLWLDFITDAENTSKGFELHFSSFELIK
CEDPGTPQFGYKVHDGGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRAWDQPLPTCVAE
CGGTVRGEVLGQVLSPGYPAPYEHNLNCVWTIEADAGCTIGLHFLVFDTEEVHDVLRIWD
GPVESGVLLKELSGPALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGV
PQNGSRSGDSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLT
GPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGRDSLSP
LIGSFYGSQLPGRIESSSNSLFLAFRSDASVSNTGFVIDYTENPRESCFDPGSIKNGTRV
GSDLKLGSSITYYCHGGYEVEGSSTLSCILGPDGKPVWNHPRPVCTAPCGGQYVGSDGVV
LSPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHNQQSRLLSSLSG
SHTGESLPLATSNQVLVKFSAKGQVPARGFHFVYQAVPRTSATQCSSVPEPRYGRRLGSD
FSVGAIVRFECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSP
GFPEPYLNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTT
VPALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDV
VSFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGTVDDMEGVILSPGFPGNYPS
NMDCSWKIALLAGLRGAHIQFLNFSTEPNHDFIEIRNGPYETSRMMGRFSGSELPSALLS
TSHETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLP
GYQLMGHPVLTCQHGTNRNWDHPLPRCEVPCGGNITSFNGTVYSPGFPSPYSSSQDCIWL
ITVPIGHGIRLNLSLLQAEPSGDFITVWDGPQKTAPQLGAFSRSFAKKTMHSSSNQALLK
FHHESAMGGIFAVAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGN
EILTCKLGTYLQFEGPPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQVCSWLVRVEP
EYNISITVEYFLSEKQYDEFEIFDGPSGQSPLLKALSGNYSAPLVVTSSSNSVYLRWSSD
HAYNRKGFKIRYSASYCSLPRAPLHGFLLGQTTTQPGGSIHFGCNAGYRLVGHSMAICTR
HPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAVYSCSEGYHLQAGAEATA
ECLETGLWSNRNIPPQCVPVTCPDISSVSVEHGRWRLIFETQYQFQAQLMLICDPGYYYT
GQRVIHCQANGKWSLDNSMPTCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLV
GSRVRECMANGLWSGSEVRCLGSIQKNEKTSGSRAIYSLFSHLIKAGHCGTPEPIVNGHV
NGENFSYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPINGLTQG
NQFNLNDVVKFVCNPGYVAEGAARSQCLASGQWSDVLPTCRIINCTDPGHQENSVRQIHA
SGPHRFSYGTTVSYQCTHGFYLLGTPVLSCQGDGTWDRPRPQCLLVSCGHPGSPPHSQMS
GDSYTVGAVVRYSCTGKRTLVGNATRMCGLDGHWTGSLPHCSGTSIGVCGDPGIPAHGIR
LGDSFAPGSLMRFSCEAGHVLRGSSERTCQLNGSWSGVQPECGGFLVISCGNPGTPSNAR
VLFSDGLVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECTVINCGDPGVPANGLR
LGSDFRYNRTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPVCKAIMCKPPQLIPNGKV
VGSDFMWGSSVTYACLEGYQLSLPAVLTCQGNGSWTGELPQCFPVFCGDPGVPARGRRED
RGFSYRSSVSFSCQPPLVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCVDPGMPQFGIQN
SSQGYQVGSTVLFRCQKGYLLQGSTSRTCLPNLTWSGTPPDCVPHHCKQPETPSHANVGA
LDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPPICLAEVRPSGRPINTAREPP
LTQASVPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQAINSKVNATMIDHSGVELHLSG
IYKKEDFHLFLQVYQITGPVEIFVNKFKDDHWALDGHVSSESSGGTFVYQGSVKGQGFGQ
FGFQRLDLRLLESDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPF
NGYAGHENTNVRATFENPMYDRNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences W5QDN4
ENSOARP00000020832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]