SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021040 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021040
Domain Number 1 Region: 529-787
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-85
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 38-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-67
Family Eukaryotic proteases 0.00038
Further Details:      
 
Domain Number 3 Region: 830-932
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-20
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 962-1047
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000837
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021040   Gene: ENSOARG00000019588   Transcript: ENSOART00000021334
Sequence length 1091
Comment pep:known_by_projection chromosome:Oar_v3.1:3:184845901:184904567:1 gene:ENSOARG00000019588 transcript:ENSOART00000021334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGAVSLLLLMLLVVHSPPSQGLKYGIRAVGLKSIETVLESGFFSRISSWRNSTVGGHPW
QVSLKLGGHHFCGGSLIQDDLVVTAVHCLISLNEKQIKSLTVTAGEYNLFQKDKEEQNSP
VSKIIIHPEYNRLGYMSFNIALLYLKLKVKFGTTVQPICIPHRGDKFEEGILCMASGWGK
ISETSEYSNILQEAVVPIMDDRTCGAMLRGMNLPPLGRDMLCASFPHGEKDACQKRDTGG
PLVCRRDDGAWVLAGITSWAARCTKVWNPFRNKQRKATPGIFSKVFVLMDFITQTMTVNI
FFSKLVKSTKNKSLLFCFSHSPLLILLHKSGNIRQALKSCFCSVALKSRGEVHVSAKGCV
LTEEGSKDLSSKGSRRPGPRAAVFPPSLHPSLPPSFPHSILPSFHPPLPPSSPSSSFPPS
IHPLLYPSLLPSILSSLHSFPPPSFCLSLLPSLPPCTILAEDQPPSCLQSKCVLFVAMTT
GRTCLLVAILFGFHHLEDFKKRLSFFSTDSLNKIGSTSFPKTNPISSAKVIPYGVCGIPP
FSPQWLSRRIAGGVEACPHCWPWQVGLRFLGNHHCGGAIINSIWILTAAHCVHSKNNPLF
WTIVAGDHDRTLKESTEQVRRAKHIVMHEDFDTLSYDSDIALIQLSSALEFNSVVRPICL
PHSLEPLFSSEICVVTGWGSVSKDGGLASRLQQIQVPVLEREVCEHTYYSAHPGGISEKM
ICAGFAASGGKDVGQGDSGGPLVCKHEKGPFVLYGIVSWGAGCAQPRKPGVFARVSVFLD
WIQSKIKDAGPVLLHIKNESKILTRQQLPPPTPSRDSASGPGCYPEVELEEPRGFFSSPR
YPLDYRGKLECSWVLRVSPRSMAKFTVEYLLLPGSRMCQDSALIIYEENHSERRMSGKLC
GRRLYPIVFMSSGPLVRVTFHSSVQGAFGINYIVFRVQGPKGSKSTQSLQSSNQEHVATC
EDGILTKPAGIIQFPRYFHRTIKSCHWRLLAPINHIIRLDIINFQKQPMPLACQGHLWVY
EGFGSGKKLIGYNVKITLVIISHKNHVARNNIEMEGNINYILHHLKEQLRDVYKSVLGKP
KLQKWASDLNE
Download sequence
Identical sequences W5QE92
ENSOARP00000021040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]