SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021164 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021164
Domain Number 1 Region: 115-413,516-523
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.67e-28
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021164   Gene: ENSOARG00000019705   Transcript: ENSOART00000021459
Sequence length 585
Comment pep:known_by_projection chromosome:Oar_v3.1:3:37992920:38006794:-1 gene:ENSOARG00000019705 transcript:ENSOART00000021459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGRLGVPRPSGWELQEGSVALGCQGPALRSRGRVGADLGGAWRGEASQGAGRAESADS
NAGGSLALQSDRSAWRAMEPAAPGLACSTLRLGLGLLLLCSWWYPGSAEPRAPPEKIAVI
GAGIGGTSAAYYLRQKFGKDVKIDVFEKGKVGGRLATFNVQGQEFESGGSVIHPLNLHMK
RFVKDLGLSAVQSPSGLVGVYNGETLVYEESSWFIINMIKLIWHYGFQSLRMHMWVEDIL
DKFMRIYRYQSHDYAFSSVEKLLHSLGGDDYLGLFNRSLLETLQKAGFSEKFLDEIITPV
MRVNYGQTTNINGFVGAVSMSGTDPGLWAVKGGNKLVCSRLLQASRSNLVSGLVMSIEEK
TRTKQTGNPSKVYEVVYQTGSETHSDFYDIVLVATPLNRKMSNINFLNFDPPIEEFHQHY
EPLVTTLIKGELNSTVFSSRALNEFHLGTVLTTDNPDLFINSIGLVSPVEEDSNPQPKAD
IAHVWKIFSAAPLTKEQILKLFVSYDYAVKQSWLAYPHYTPPEKCPSIILHDRLYYLNGI
EFAASAMEMSAIAGYNAALLAYHRWNGNTHMIDQEDLYERLKTEL
Download sequence
Identical sequences W5QEL6
ENSOARP00000021164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]