SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021178 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021178
Domain Number 1 Region: 259-470
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.58e-57
Family Reprolysin-like 0.00044
Further Details:      
 
Domain Number 2 Region: 558-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000353
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 1206-1266
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000772
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 1079-1137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000105
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 1024-1080
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 1156-1209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 7 Region: 1359-1418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 963-1025
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 9 Region: 1422-1477
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 1309-1362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 1658-1713
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000119
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 12 Region: 1528-1591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 1472-1533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 14 Region: 852-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000021178
Domain Number - Region: 1597-1641
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00523
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Domain Number - Region: 907-965
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0144
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021178   Gene: ENSOARG00000019717   Transcript: ENSOART00000021473
Sequence length 1915
Comment pep:known_by_projection chromosome:Oar_v3.1:3:142961377:143166195:1 gene:ENSOARG00000019717 transcript:ENSOART00000021473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVKWLTGLLYQLSLFITRSWEVHFHPRQEALVRTLASYEVVTPARVNEFGEVFPQSHH
FSRRKRSSETLEPTPFRTHYRIRAYGQLFQLNLSADAAFLAAGYTEVHLGTSAHPAEERS
AAPADLRHCFYRGQVNAREDHTAVFSLCGGLMGTFKAHDGEYFLEPIMKADGSEHEDDHS
KPHLIYRQELKGNYFLQSHKPCDASESEIKKTTLPFHNYSDINENLNIKEERVLGYTSKN
MSLEDERSQLHSRKKRFLSYPRYVEVMVTADSKMVHHHGQNLQHYVLTLMSIVAAIYKDS
SIGNLINIVIVKLVIIHDEQEGPVISFNAATTLRNFCLWQQTQNVLDDAHPSHHDTAVLI
TREDICGAREKCDTLGLAELGTLCDPLRSCSISEENGLSAAFTIAHELGHVFNVPHDDSF
KCKETGIKHQYHVMAPTLNYHTSPWTWSKCSQKYITEFLDTGHGECLLDKPNGRIYDLSS
QLPGLMYDVNKQCELMFGPGSQVCPYLKQCRRLWCTSAEGVHKGCRTQHMPLADGTNCGP
GMHCHHGLCVNKEMETRPVDGDWGPWGPYSSCSRTCGGGIKSTSRLCNRPEPRNGGKYCV
GRRMKFRSCNTDSCPKGKQDFREKQCSDFDGKHFNINGLSPNVRWLPKYSGIAVKDRCKL
YCRVAGTTSFYQLKDRVADGTPCGTETNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGD
NSSCRTMAGVFNSAHYGYNVVVKIPPGATNIDILQHSYSGKPEDDNYLALSDTQGNFLLN
GNFVVSMSKREINVQGAIFEYSGSNNSIERINSTDRLEEELVLQVLCVGNLYNPDVRYSF
NIPVEEKSDLFTWDPYGPWQDCTKMCQGLHRRKITCVRRSDHMVMSDQSCDHLPLPLLVT
ERCNTDCELRWHIIGKSECSTLCGQGYKSLDVHCMKYSIHKGQTVPVDDHYCSDQLKPPT
REPCHGDCVLTRWHYLEWSQCSRSCGGGERSRESYCINNFGHRLADRECQELPRVTTENC
NEFSCPSWATSEWSECLVTCGKGTKQRQVWCHLNEDHLSDGFCDPSTKPESQRPCELHAC
TSWQVGPWGSCTATCGQGYQMRAVKCVNELFSTVLDDRLCHGASRPSERQNCIVTPCPVI
PKIGATSLPAVPMRKITQWRYGSWTPCSVSCGRGNQARYVSCRDAHDGIADESFCAHLPR
PAEIAVCFSPCGEWQTGNWSPCSASCGRGKMTRQVLCINYHQPVNENYCDPEVRPVIEQE
CNLAACPPTYSHFPSSSEQPSHFPGRNFPLTHKPEDNQNQRVHPSIRENQWRTGPWGSCS
SSCAGGVQRRVVVCQDENGQSASYCDAASKPPESKHCDSGPCPQWNYGSWGECTQTCGGG
IKSRFVICQFPDGQLSQEQNCEMLNKPPSVVQCHIHACPDDVSWHRGPWKSCSASCGKGL
KYREVLCIDQFHRKLEEKYCSHLQKPRTHKACRSVRCPSWKANRWKECSVTCGSGVQQRD
VYCRLRGVGPVAEEKCDPSTRPYFQRECWHRDCIQHHWAAGEWLDCSVSCKKRETYRQVK
CMDAQNIQVSESFCDLATRPLAVKKCRNSPCKYIVVTGDSSQCAGNCGFSYRQRITYCVG
VQSMEKHKLHELWPIDYRVCPVLPSPQVYKCNFRTCLHMATWKVGKWSKCSVTCGVGMME
RRVECMADNGLSSDLCLKHLKPDAQKKCYVSDCKTFMSCKEIQVKNNITKDGDYYLNIKG
RITKIYCAGMHLENPKEYLSLVKGEEDNFSEVYGFRLRNPYECPFNGSRRHDCECKNDYL
AAGHTVFSKIRIDLTSMQIKTTDLLFAQTIFGNAVPFATAGDCYSAARCPQGQFSINLAG
TGMKISSTAKWLAQGSYASVIIHRSQDGTKVYGRCGGFCGKCIPHMTTGLPIQVV
Download sequence
Identical sequences W5QEN0
XP_004006484.1.66739 ENSOARP00000021178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]