SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021275 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021275
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000051
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021275   Gene: ENSOARG00000019811   Transcript: ENSOART00000021571
Sequence length 262
Comment pep:known_by_projection chromosome:Oar_v3.1:1:12198285:12212782:-1 gene:ENSOARG00000019811 transcript:ENSOART00000021571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLCVVALVLSWMHLAAGSRGIKGKRQRRISADGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIIAKIEHCGACFSHNFCTKCQESLYL
HKGRCYPACPEGSAPADGAMECSSPAQCEMSEWSLWGPCSKKKKLCGFRRGLEERTRRVL
HAPGGDHAVCSDTKETRRCTVRRTPCPEGQKRRKGSQGRRENANRNPSRKESKEAGTGAR
RHKGQQQQQQGTVGPVTSAGPT
Download sequence
Identical sequences W5QEX7
ENSOARP00000021275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]