SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021286 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021286
Domain Number 1 Region: 240-603
Classification Level Classification E-value
Superfamily SIS domain 6.31e-104
Family double-SIS domain 0.000000414
Further Details:      
 
Domain Number 2 Region: 7-134,171-215
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.72e-40
Family Class II glutamine amidotransferases 0.0000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021286   Gene: ENSOARG00000019823   Transcript: ENSOART00000021583
Sequence length 603
Comment pep:known_by_projection chromosome:Oar_v3.1:3:38829991:38883147:1 gene:ENSOARG00000019823 transcript:ENSOART00000021583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLES
KGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQA
VGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCSLSRVDSTTCLFPVEEKAVEYY
FASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMK
GNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSY
HAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLMGLRYCKE
RGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRIS
MQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALK
IKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVV
ICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSV
TVE
Download sequence
Identical sequences W5QEY8
ENSOARP00000021286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]