SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021366 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021366
Domain Number 1 Region: 51-148
Classification Level Classification E-value
Superfamily F-box domain 2.35e-20
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021366   Gene: ENSOARG00000019899   Transcript: ENSOART00000021666
Sequence length 175
Comment pep:known_by_projection chromosome:Oar_v3.1:3:39742140:39743227:1 gene:ENSOARG00000019899 transcript:ENSOART00000021666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTFAFQFIYEDNSLKYQAMKKNSKRNHASRVSDIESNSVDAEKEKKECQNNFVELLPP
EVTFKIFSQLDIRSLCRASATCRSWNHAIRHSDSLWKPHCLTVRAVCQREIDDDLESGYP
WRIILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER
Download sequence
Identical sequences W5QF68
ENSOARP00000021366 XP_014949784.1.66739 XP_014949785.1.66739 XP_014949786.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]