SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021505 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021505
Domain Number 1 Region: 36-97
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000235
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Domain Number 2 Region: 571-624
Classification Level Classification E-value
Superfamily F-box domain 0.00000262
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021505   Gene: ENSOARG00000020029   Transcript: ENSOART00000021807
Sequence length 714
Comment pep:known_by_projection chromosome:Oar_v3.1:1:184374043:184390660:1 gene:ENSOARG00000020029 transcript:ENSOART00000021807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTRRPPPGQHRHCERCFSRDCHMPLEPSVSCPVINCHLSCGATFHMCKEAEHELLCPL
EQVPCLNSEYGCPLFMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKETP
DEECLDTALALQDQKVLFRSLKMVELFPETREPMEEEPPVNGEASWEEMGGAVGGEDAGL
ETGCSLSAMNGEVVELSQEEREALAKTKEGMDLAKFDKWENMFSKEHAASALTSSSASSD
SKSRNSPEKEQISSSNRTVEEGAAKGKEPQEDQKQQDFHTAIEKTGLAPWQDGVLERLKT
AVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVYTFKVPVSYCGKR
ARLGDAMSCRPSEHKAVDTSDLGITVEDLPKSDLIKTTLLCALERELKGHVISESRSIDG
LFMDFATQTYSFEPEQFSSGTVLADLLTTANPNSNANGLHVELHSECVTRRHNKSSSAFT
FTCNKFFRRDEFPLHFKNVHTDIQSCLNGWFQHRCPLAYLGCTFIQNHFRPPGQKAKVIY
SQELKTFAIKPEVASELSEGRKNNHFSGREGKNQNSLTSLPLEVLQYIAGFLDSISLSQL
SQVSVLMRSICATLLQERGMVLLQWKKKRYSHGGTSWRVHRKIWQFSSLFSKIKSWEFND
VASMSEHLKSCPFNVVEHKTDPILLTSMCQSHEQARETLVTTFRARPRGRHTLR
Download sequence
Identical sequences W5QFK7
ENSOARP00000021505 XP_004003009.1.66739 XP_014947956.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]