SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021538 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021538
Domain Number 1 Region: 1047-1261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 120-324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-39
Family Laminin G-like module 0.00000000521
Further Details:      
 
Domain Number 3 Region: 924-1045
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.1e-37
Family TSP type-3 repeat 0.000000149
Further Details:      
 
Domain Number 4 Region: 581-638
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.62e-17
Family TSP-1 type 1 repeat 0.0000154
Further Details:      
 
Domain Number 5 Region: 527-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.92e-16
Family TSP-1 type 1 repeat 0.0000366
Further Details:      
 
Domain Number 6 Region: 856-926
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000379
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 409-466
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000481
Family VWC domain 0.007
Further Details:      
 
Domain Number 8 Region: 783-867
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000301
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 471-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 639-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000055
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021538   Gene: ENSOARG00000020058   Transcript: ENSOART00000021840
Sequence length 1286
Comment pep:known_by_projection chromosome:Oar_v3.1:7:32243494:32406527:1 gene:ENSOARG00000020058 transcript:ENSOART00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRGLPLVRGNPRNVSAPLKARGSSAPPATALGPAAESPPWRALPAAASESTASTPRLS
SSLSRRCALVAGPGRYIRVRTGSLLGTNSSTMGLAWGLGVLLLVHACGSNRIPESGGDNS
VFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDKKFQDLVDAVRAEKGFL
LLASLRQMKKTRGTLLAVERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLA
TGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSIFTRDLASIARLRIAKGGVNDNFQ
GVLQNVRFVFGTTPEDILRNKGCSSSATSVFLTLDNNVVNGSSPAIRTDYIGHKTKDLQA
ICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRTG
DEWTVDSCTECRCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEW
TSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCS
VTCGDGVITRIRLCNSPSPQMNGKPCEGKARETKACQKDACPINGGWGPWSPWDICSVTC
GGGAQKRSRLCNNPTPQFGGKDCVGDVTETQICNKQDCPIDGCLSNPCFAGVQCTSYPDG
SWKCGACPPGYSGDGVKCEDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQ
PFGRGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGII
CGEDTDLDGWPNEDLLCVANATYHCRKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIP
DDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILN
ERDNCQYVYNVDQKDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQ
NNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDGRGD
ACKDDFDQDKVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQ
TVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYW
DTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAY
RWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECR
DSSSAPFTTTNTSLISESPLWSPSNY
Download sequence
Identical sequences W5QFP0
ENSOARP00000021538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]