SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021604 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021604
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Cystatin/monellin 4.13e-30
Family Cystatins 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021604   Gene: ENSOARG00000020121   Transcript: ENSOART00000021906
Sequence length 98
Comment pep:known_by_projection chromosome:Oar_v3.1:1:185039018:185050404:1 gene:ENSOARG00000020121 transcript:ENSOART00000021906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGGLTEAKPATPEIQEIANTVKPQLEGKTNETYEEFTAIEYKTQVVAGINYYIKIQTG
DNRYIHIKVFKSLPQQNQSLTLTGYQVDKTKDDELTGF
Download sequence
Identical sequences W5QFV6
ENSOARP00000021604 XP_004003021.1.66739 XP_005675079.1.57651 XP_005971695.1.78601 XP_012018382.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]