SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021662 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021662
Domain Number 1 Region: 60-502
Classification Level Classification E-value
Superfamily Sema domain 3.79e-139
Family Sema domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 794-851
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 3 Region: 607-657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000916
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 851-908
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000222
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 498-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 911-954
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 552-604
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000929
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000021662
Domain Number - Region: 661-714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0301
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021662   Gene: ENSOARG00000020173   Transcript: ENSOART00000021964
Sequence length 1095
Comment pep:known_by_projection chromosome:Oar_v3.1:1:185521338:185559506:-1 gene:ENSOARG00000020173 transcript:ENSOART00000021964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLPSGAGTVEGPTMVFPGPLAVTLLVVHLACSQDVAGEASGEQQLCSLREHPIVAFADL
KPWVSNFTYPGAQDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASNEDTRRS
CQSKGKTEEECQNYVRVLIVTGRKVFMCGTNAFSPVCSSRQVGNLSRTVEKINGVARCPY
DPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSRPPLRTAQYNSKWLNEPNFVAAY
DIGLFAYFFLRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGE
VPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRA
AWLPIANPIPNFQCGTLPEVGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRF
SHLVVDLVQAKDTLYHVLYIGTGSGATLRFNLRGCYLEELHVLPPGRREPLRSLRIVHSA
RALFVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQN
ITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRSRACDSPRPRCGGLECLGPAIH
IANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENT
PCPVPLFWASRGSWSECRQTGRDRSAGAGQGLHACETAPDLTPKEFKTCNPEACPEVRRN
TPWTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGRRRMETRTCPADGSGACDTDA
LVEDLLRSGGASPLMVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDA
AEYQDCNPHACPVRGAWSCWTAWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEE
ALCATQACPEGWSPWSEWSACTEDGVQSRDRHCEELVPGPSTCSGNSSQSRPCPYSEIPV
ILPASSVDEATSCGGFSLIHLVATGISCFLGSGLLTLVVYLSCQHCQHQSQESTLVHPAT
PNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHS
FRPEASPGQRCFPNS
Download sequence
Identical sequences W5QG14
ENSOARP00000021662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]