SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021711 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021711
Domain Number 1 Region: 241-481
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.16e-55
Family Decarboxylase 0.000000526
Further Details:      
 
Domain Number 2 Region: 17-208
Classification Level Classification E-value
Superfamily PRTase-like 1.7e-44
Family Phosphoribosyltransferases (PRTases) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021711   Gene: ENSOARG00000020220   Transcript: ENSOART00000022014
Sequence length 484
Comment pep:known_by_projection chromosome:Oar_v3.1:1:187408952:187455134:1 gene:ENSOARG00000020220 transcript:ENSOART00000022014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSGTMAAADAPLGSLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRILSQVAEI
LFQTAQNAEINFDTVCGVPYTALPLATVICSTHQIPMLIRRKETKDYGTKRLIEGAVNPG
ETCLIIEDVVTSGSSVLETAEVLQKEGLKVTDAIVLLDREQGGRDKLQAHGIRLHSVCTL
SKMLDILEQQKKINAEMVERVKRFIQENVFVAASPNGSLPSVKKEPKELSFGARAELPGI
HPVASKLLRLMQKKETNLCLSADISESRELLQLADALGPRICLLKTHVDILNDFTLDVMK
ELTTLAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLGE
VGLPLHRACLLIAEMSSAGTLATGSYTEAAVKMAEEHSEFVVGFISGSRVSMKPEFLHLT
PGVQLEAGGDNLGQQYHSPQEVIGKRGSDIIIVGRGIIASANHLEAAEMYRKAAWEAYLS
RLAV
Download sequence
Identical sequences W5QG62
ENSOARP00000021711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]