SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021741 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021741
Domain Number 1 Region: 373-475,506-751
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.05e-111
Family Oxysterol-binding protein 0.0000485
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021741   Gene: ENSOARG00000020246   Transcript: ENSOART00000022044
Sequence length 756
Comment pep:known_by_projection chromosome:Oar_v3.1:1:188235526:188333078:-1 gene:ENSOARG00000020246 transcript:ENSOART00000022044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGVKMQGGEPVSAMKVSESEGRLEGLATAVTPNKNSGNSGCGGGISSSSSSRGGSAKG
WQYSDHMENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGA
VISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSR
SFSLASSGNSPISQRRPSQNTISFFNVGHSKLQSVSKRANLPPDHLVEVREMMSHAEGQQ
RDLIRGIECLPASGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQKGSLPSGT
TIEWLEPKIPLSNHYKNGADQPFATEQSKPVAVPEEQCVAESGLLAREPEEINADDEVED
TCDNKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDL
FIAITNGATAEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWRMPKSEVASS
VINSSSTQAITNHVPPSEEALNQMGSDCYTVRFVAEQVSHHPPVSGFYAECAERKMCVNA
HVWTKSKFLGMSIGVTMVGEGILSLLEHGEEYTFSLPCAYARSILTVPWVELGGKVNVNC
AKTGYSASITFHTKPFYGGKLHRVTGEVKHNITNTVVCRVQGEWNSVLEFAYSSGETKYV
DLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRDSEIDKATEHKRTLEERQRTEERHR
TETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPAE
Download sequence
Identical sequences W5QG92
ENSOARP00000021741 XP_004003041.1.66739 XP_011980697.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]