SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021852 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021852
Domain Number 1 Region: 84-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-54
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 38-74
Classification Level Classification E-value
Superfamily F-box domain 0.00000000327
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021852   Gene: ENSOARG00000020347   Transcript: ENSOART00000022157
Sequence length 287
Comment pep:known_by_projection chromosome:Oar_v3.1:1:189337759:189348646:1 gene:ENSOARG00000020347 transcript:ENSOART00000022157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGATGAPRGGRTSPPAPAPAARRGRGGAGAGSGSGAGGRLPSRVLELVFSYLELSELRSC
ALVCKHWYRCLHGDEKARCGWSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDC
SRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAP
MQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDK
TLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences W5QGK3
ENSOARP00000021852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]