SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021953 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021953
Domain Number 1 Region: 39-166
Classification Level Classification E-value
Superfamily Lysozyme-like 8.31e-51
Family C-type lysozyme 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021953   Gene: ENSOARG00000020439   Transcript: ENSOART00000022258
Sequence length 167
Comment pep:known chromosome:Oar_v3.1:3:150313875:150318870:-1 gene:ENSOARG00000020439 transcript:ENSOART00000022258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSKSSSPWSVWTLDFSVNMKALVILGLLFLSVAVQGKVFERCELARTLKKLGLDDYKG
VSLANWLCLTKWESGYNTKATNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCS
ALMENDIEKAVACAKHIVSEQGITAWVAWKSHCRDHDVSSYVEGCTL
Download sequence
Identical sequences W5QGV4
ENSOARP00000021953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]