SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021958 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021958
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 1136-1268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000102
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 937-1067
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000148
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 594-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000165
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 412-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 783-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 7 Region: 757-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000584
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 291-461
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000753
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 10 Region: 260-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000191
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 182-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 13 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000578
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 15 Region: 1264-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family EGF-type module 0.008
Further Details:      
 
Domain Number 16 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000768
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 107-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000967
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 19 Region: 1064-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family EGF-type module 0.023
Further Details:      
 
Domain Number 20 Region: 1376-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 21 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0016
Further Details:      
 
Domain Number 22 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000667
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 33-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000914
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000021958
Domain Number - Region: 1466-1497
Classification Level Classification E-value
Superfamily Notch domain 0.000915
Family Notch domain 0.0076
Further Details:      
 
Domain Number - Region: 1118-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0542
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 917-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0754
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021958   Gene: ENSOARG00000020442   Transcript: ENSOART00000022263
Sequence length 2471
Comment pep:known_by_projection chromosome:Oar_v3.1:1:96427312:96607126:-1 gene:ENSOARG00000020442 transcript:ENSOART00000022263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPAPLWALLALWLCRAAPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCALGFTGEDCQHSTTHPCFVSQPCLNGGT
CHVLSRDTYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCTCLAGFTGQKCE
ADVNECDIPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQAG
DFTFECSCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGSDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLTGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAGVCKEAPNFESYSCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCIDGINSFSCLCPVGFTGS
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
DKAESRCLCPSGWAGAYCDVPSVSCEVAASRRGVPVDRLCQHSGVCISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSSPCSSEGSLDCIQLTNDYLCVCRSTFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGVRCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFRGSHCELYSTPTSTPPATCLSQYCADKARDGICD
DVCNSHACQWDGGDCSLTMEDPWANCSSPLPCWEYINNQCDELCNTAECLFDNFECQKSS
KTCKYDKYCADHYEDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQ
DARRFLRALGTLLHTNLRIKRDAQGELMVYPYYGGKSAAMKKQRLTRRSLPGDEEQEVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLAPKRTPLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSMALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPNTKSAVPTSLPNLAKEAKDAKGNRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPTPMLATAAPTGPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHHHIVPPGSSTAGSVGRLHPVPVPADWMNRVEVNESQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHLTTPREPLPPIVTFQLIPKGSIAQPTGAAQPPSNCPPAVAGTLPTMY
QIPEMARLPSMAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPRSNMQVYA
Download sequence
Identical sequences W5QGV9
ENSOARP00000021958 XP_004002441.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]