SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021999 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021999
Domain Number 1 Region: 64-367,534-567
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-48
Family FAD-linked reductases, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021999   Gene: ENSOARG00000020479   Transcript: ENSOART00000022304
Sequence length 609
Comment pep:known_by_projection chromosome:Oar_v3.1:3:57047396:57061814:-1 gene:ENSOARG00000020479 transcript:ENSOART00000022304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVSLLLLAALLLVILGKVYKGLFSGSSPNPFLEDVKRPPAPLVTDKEARKKVLKQAFSV
SRVPKNLDVVVIGSGFGGLAAAAILAKTGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIH
YIGRMQEGSFDRFILDQITEGQLDWAALPSPFDIMVLEGPDGRKEFPMYAGMKAYIQGLK
DKFPQEEAAIDKYMKLVKVVSRGAFYVILLKILPLPVAQLLTKYGLLTRFSPFLRASTQS
LAEVLQQLPASPELQAVLSYIFPTYGVTPSHTTFAMHALLVNYYLKGAFYPRGGSSEIAF
HTIPVIQRAGGAVLTRAPVHSILLDSAGKACGVTVKKGEDLVNIYCPIVISSAGLFNTYE
HLLPEQARCLPGVKRQLGMVRPGLSMFSVFICLRGTKKDLELPTTNYYIYFDKDMDKAME
HYVSLPGDKAAAHMPLLFISFSSAKDPTWEDRYPDRSTAVILIPTSYEWFKEWRDEPQGK
RSSAYETLKSSFVEAAVSVFLKQFPHLEGKVDSVTGGSPLSTQFYLAAPQGACYGADHDL
GRLHPGAMASIRAQSPIPNLYLTGQDILTCGLIGALQGALLCSSAILKRNLYLDLWKLGS
RIQAQKKKN
Download sequence
Identical sequences W5QH00
ENSOARP00000021999 XP_004005915.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]