SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022021 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022021
Domain Number 1 Region: 401-696
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.16e-79
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-33
Family Spermadhesin, CUB domain 0.0000159
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022021   Gene: ENSOARG00000020498   Transcript: ENSOART00000022326
Sequence length 699
Comment pep:known_by_projection chromosome:Oar_v3.1:1:198236799:198300463:1 gene:ENSOARG00000020498 transcript:ENSOART00000022326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLSHALCFSLLKASAHIVELNNMFGQIQSPGYPDAYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSDEERFTGFDAHYVAVDVDECTEREDEELSCDHHCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPSPYPKSSECLYTIELEEGFMISLQFEDIFDIEDHPEV
SCPYDYIKIKAGPKVLGPFCGEKAPEPINTQSHSIQILFRSDNSGENRGWRLSYRATGNE
CPKLQPPVHGKIEPLQTIYSFKDQVLISCDTGYKVLKDNVEMDTFQMECLKDGTWSNKMP
TCKIADCGAPAELENGVVTFSTRNNLTTYKSEIRYSCQRPYYKMLRNTTGVYTCSAQGVW
MNEVLGRSQPTCLPVCGIPKFSRNLLARIINGRPTQKGTTPWIAMLSHLNGQPFCGGSLL
GSKWIVTAAHCLHEVPDSEDVTLHDLDLLSPSAFKIIMGKLRRTQSDENEQSLSVKQVFF
HPLYNPNTYENDVALLELSRGPVLNDFVMPICLPQGPPEEGAVVIVSGWGKQFLQRFPET
LMEIEIPIIDYHICREAYAPLKKKVTRDMICAGEKEGGRDACAGDSGGPMVTLDTKRGQW
YLVGTVSWGVDCGKKDRYGVYSYIFYNKDWIRRVTGMSD
Download sequence
Identical sequences W5QH21
ENSOARP00000022021 XP_011952781.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]