SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022048 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022048
Domain Number 1 Region: 174-271
Classification Level Classification E-value
Superfamily AMPKBI-like 6.02e-36
Family AMPKBI-like 0.00000461
Further Details:      
 
Domain Number 2 Region: 75-155
Classification Level Classification E-value
Superfamily E set domains 3.36e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022048   Gene: ENSOARG00000020520   Transcript: ENSOART00000022353
Sequence length 271
Comment pep:known_by_projection chromosome:Oar_v3.1:1:97167794:97179392:-1 gene:ENSOARG00000020520 transcript:ENSOART00000022353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSDRVAGERHGAKAARAEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVS
WQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences W5QH48
XP_004002445.1.66739 XP_012013810.1.54773 XP_013817925.1.57651 XP_017901485.1.57651 ENSOARP00000022048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]