SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022053 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022053
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0042
Further Details:      
 
Domain Number 2 Region: 315-489
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000189
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022053   Gene: ENSOARG00000020524   Transcript: ENSOART00000022358
Sequence length 536
Comment pep:known_by_projection chromosome:Oar_v3.1:1:97198475:97235884:-1 gene:ENSOARG00000020524 transcript:ENSOART00000022358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKRIAVIGAGVSGLTSIKCCLEEGLEPLCFERSHDIGGLWRFQEEPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
PTSGQWEVVTESEGKKEVYVFDGVMVCTGHHTYAHLPLESFPGIEKFKGQYFHSRDYKNP
DSLTGKRVIIIGIGNSGGDLAVEISHRAKQVFLSTRKGAWILNRVGDCGYPFDTILSSRF
NHLLKKITGESAANAYLEKKINQRFNHEMFGLKPKHSIHRVFSQHPTVNDDLPNRIISGF
VKVKTNVKEFTETAAIFEDGSREDDIDVVIFATGYSFAFPFLEDSVKVVKNKISLYKKVF
PPNLEKPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPPQSEMMTEIAKVQEDMA
KQYVESQRHTIQGDYIGTMDELADLVGVKPNLLSLAFTDPKLAFQLFWGPCTPIQYRLQG
PGKWDGARKVILTTQDRIKKPLMTRIVETDNSNTSTITMAKFMLAVVFFAIVMTYL
Download sequence
Identical sequences W5QH53
ENSOARP00000022053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]