SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022058 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022058
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.11e-35
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 251-329
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.22e-19
Family HSP40/DnaJ peptide-binding domain 0.00083
Further Details:      
 
Domain Number 3 Region: 129-152,193-252
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000115
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022058   Gene: ENSOARG00000020530   Transcript: ENSOART00000022363
Sequence length 358
Comment pep:known_by_projection chromosome:Oar_v3.1:1:198836685:198852288:-1 gene:ENSOARG00000020530 transcript:ENSOART00000022363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQNLGTFCLLLLYLIGTVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHSIFERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLSEEAREGIKQLLKQGSVQKVYNGLQGY
Download sequence
Identical sequences A0A212CJX7 L8HN38 Q3ZBA6 W5QH58
ENSBTAP00000004094 NP_001029440.1.59421 NP_001029440.1.76553 XP_004003111.1.66739 XP_005201525.1.76553 XP_005675219.1.57651 XP_005910819.1.15283 XP_005981576.1.78601 XP_006058686.1.26621 XP_010852195.1.44457 XP_011997870.1.54773 XP_011997871.1.54773 XP_017902400.1.57651 XP_019814003.1.53367 ENSOARP00000022058 9913.ENSBTAP00000004094 ENSBTAP00000004094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]