SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022129 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022129
Domain Number 1 Region: 144-457
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.01e-75
Family Transglutaminase core 0.00000229
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 7.7e-44
Family Transglutaminase N-terminal domain 0.00027
Further Details:      
 
Domain Number 3 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.33e-29
Family Transglutaminase, two C-terminal domains 0.00075
Further Details:      
 
Domain Number 4 Region: 474-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-26
Family Transglutaminase, two C-terminal domains 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022129   Gene: ENSOARG00000020591   Transcript: ENSOART00000022434
Sequence length 691
Comment pep:known_by_projection chromosome:Oar_v3.1:7:35461066:35480288:-1 gene:ENSOARG00000020591 transcript:ENSOART00000022434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STAGLVIKSCDFQAARNNAEHHTNDISSQRLIVRRGQPFTISLHFQAPVHTFLRALKKVA
FVAQTGKQPSMASGTQVTFSVSSLGDRKWWSAMVEERDDQSWTISVTTPADAIIGHYSLL
LQISGRKQCLGQFTLLFNPWNREDAVFLGNEAQRREYLLNQNGLIFLGTADCIQAEPWDF
GQLEEDVIDLGLRLLTVDKQVEKWGNPVHVAQVLGSLLQILKEKLVLPTAKIQTTEERAL
LNKRRGSAPILRQWVTGHGRPVYEGQAWVLAAVAFHSFHAVLRGLGIPARVVTTFTSAQG
TGGDLLVDEYYNEEGLQNGEGNRGRAWIFQTSTECWMARPALPEGYDGWQILYLSALKGD
EVLEACDLVPVKAVKEGTVWLSPAVSDIFASINASCVVWRCREDGTLELTDCNTKYFGNN
ISTKNVDCDRREDITQNYKYPEGTRQEKKVLEKVQKYRMECKNNGIHPPSCETDDPLQLF
LKAPSSLALGKNVEFSVNLLNPSDQEKEVQLAVGLQAVYYNGVLAAKLWRKKFVLTLSAN
SAEKISTSLFNSSFEQNLPENSFLRLTAMATHSSLPCFAQQDIAICRPHLAIEMPETAEQ
NQPLMALVSIHNPLDVPLEDCVISIFGRGLIYREKSYRVNSVQPRNTLHTQLKFVPVKVG
CQRLTVEMDCNMFQNLTNFRTVMVVAPEPPA
Download sequence
Identical sequences W5QHC9
ENSOARP00000022129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]