SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022156 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022156
Domain Number 1 Region: 58-131
Classification Level Classification E-value
Superfamily F-box domain 2.49e-16
Family F-box domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022156   Gene: ENSOARG00000020617   Transcript: ENSOART00000022461
Sequence length 149
Comment pep:known_by_projection chromosome:Oar_v3.1:2:231092509:231126970:1 gene:ENSOARG00000020617 transcript:ENSOART00000022461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVIFRWWKISLRSEYRSAKPGETKETHEDFLEKSHLQVQIALVFGSKILDYVFNLCEGKF
DFLERLSDSLLLNIISYLDLEDIARLSQTSRRFAKLCMSEELWEQITPDMRALAQDLGWR
RMYFTNKLQLQRHLRKRKQRQGSQRKQSA
Download sequence
Identical sequences W5QHF6
ENSOARP00000022156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]