SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022174 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022174
Domain Number 1 Region: 3-293
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-41
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022174   Gene: ENSOARG00000020633   Transcript: ENSOART00000022479
Sequence length 417
Comment pep:known_by_projection chromosome:Oar_v3.1:7:40246418:40290279:-1 gene:ENSOARG00000020633 transcript:ENSOART00000022479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSFDIVIIGGGIVGLASARALILRHPALSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPE
SLKAKLCVQGAALIYEYCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRL
IQQEDIKKKEPYCRGLMAIDCPYTGIVDYRQVALSFAKDFQEAGGSILTSFEVEDIEMAR
ESPSRSKDGMKYPIVIRNTKGEEVQCQYVVTCAGLYSDRISELSGCNPNPRIVPFRGDYL
VLKPEKRYLVKGNIYPVPDSRFPFLGVHFTPRMDGNIWLGPNAVLAFKREGYRPFDFSAR
DIMDIIIKSGLIKLVFQNFSYGVNEIYKACFLSATVKHLQKFIPEITISDILRGPAGVRA
QALDRDGNLIEDFVFDGGVGDIGNRILHVRNAPSPAATSSLAISGMIADEVQQRFKL
Download sequence
Identical sequences W5QHH4
ENSOARP00000022174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]