SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022371 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022371
Domain Number 1 Region: 305-603
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.97e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000212
Further Details:      
 
Domain Number 2 Region: 126-304
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.49e-42
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00055
Further Details:      
 
Domain Number 3 Region: 605-712
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.32e-25
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 64-126
Classification Level Classification E-value
Superfamily TGS-like 0.00000000255
Family TGS domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022371   Gene: ENSOARG00000020814   Transcript: ENSOART00000022676
Sequence length 722
Comment pep:known_by_projection chromosome:Oar_v3.1:1:99428961:99440451:1 gene:ENSOARG00000020814 transcript:ENSOART00000022676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRCRRLRFPGLHACGLHTVREAAVPTPPHWLVERLGYFEELWTAQVKRLASMAQEE
QRTIKISLPGGQKVDAVAWKTTPYQLAQQIRSSNLADTAVAAQVNGEPYDLERPLETDAD
LRFLTFDSAQGKAVFWHSSTHVLGAAAEQLLGAVLCQGPSTECGFYHDFFLGKERTVKGS
ELPVLERICQDLAAAAQPFRRLEASQAQLRQLFKDNPFKLRLIEEKVTGPTATVYGCGML
VDLCRGPHLRHTGQIGGLKLLSNSSSVWRFPGAPETLQRVSGISFPTAEELRAWEEWRED
AELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYTRRGFSEVKTPTL
FSTKLWELSGHWKHYREDMFALQPPGLDRPSSSQSDHSASPAADTLALKPMNCPAHCLMF
AHRPRSWRELPLRLADFGALHRAEASGSLGGLTRLRCFQQDDAHIFCAPDQLQAEIRGCL
DFLHSVYTILGFSFHMALSTRPSGFLGEPCLWDQAEQVLQQALEEFGAPWDLNPGDGAFY
GPKIDVHVRDALGRPHQCGTIQLDFQLPLRFDLQYKGQSGALERPVLIHRAVLGSVERML
GVLAESCGGKWPLWLSPFQVVVIPVGTEQEEYAREAQQSLQAAGLVGDLDADSGLTLSRR
IRRAQLAHYNFQFVVGQREQSKRTVNIRTRDNRRLGEWDLAEAIQRLLELQDTRVPNAEE
IF
Download sequence
Identical sequences W5QI21
ENSOARP00000022371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]