SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022383 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022383
Domain Number 1 Region: 44-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 969-1020
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 777-835
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 719-777
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000929
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 5 Region: 907-965
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 839-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 661-717
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000798
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022383   Gene: ENSOARG00000020825   Transcript: ENSOART00000022689
Sequence length 1069
Comment pep:known_by_projection chromosome:Oar_v3.1:1:99481959:99490157:1 gene:ENSOARG00000020825 transcript:ENSOART00000022689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKWAGRPWLCLMLLLSLPQLCLDQEVLSGHSLQTPSEESQGPEGVWGPWDQWASCSQPC
GVGVQRRSRTCQLPTIQLHRGLPLPPRPPRHPEALLPRGQGTRPQTSRETLPLYRPPPRG
RGGPLRGPASQLGREEAPDTQGARRSRVRDPIKPGMFGYGRVPFALPLHRNRRHPRRPPR
SELSQTSDLPSLTPRTEPPSTNHTQKTELSPTESSAHTLPPQVEPSPEAAQTAVPSRARP
APTRPHPRAQASGTEPSFHSPSPGEGSSFHLSLQPRRPSSQGWASPRLADRHPNPFLSVP
WGRGQQSREQWRPGGHLHGSLTESAPPQPDGWLPLLSSGPNSSPLWSLFAPSSPVPRCSG
ESEQLRACSQAPCPPEQPDPRALQCAAFDSQEFMGQLYQWEPFTEVQGSQRCELNCRPRG
FRFYVRHTQKVQDGTLCQPGALDICVAGRCLSPGCDGILGSGRHPDGCGVCGGDDSTCRL
VSGNLTERGGPLGYQKILSIPAGASRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPG
SYTAGGTVFRYNRPPREEGAGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISSPPPNL
ENPTPEPRVPQLQPEILRVEPPPVSAPRPARTPGTLQRQVRIPQMPAPPPPRTPMGSPAG
YWKRVGHSECSASCGKGVWRPIFLCVSRESGDELDERSCAMGARPPASQEPCHGPPCPPY
WEAGEWTSCSRSCGPGTQHRQLRCRQEFGGGGSSVPPERCGHLPRPNITQPCQLRLCGHW
EVRSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPRPPSREACDMGPCTTAWF
HSDWSSKCSAECGTGIQRRSVVCLGSGEAHGISQEEAGAGAGEQTCAPGSRPPDMRACSL
GPCEVSWCWYTGPWAECSSECGSGTQRRDVICVSKLGTEFNVTSPSNCSHLPRPPALQPC
QGQDCQDRWFSTPWSPCSRSCQGGVQTREVQCLTANQTLSIRCPLHLRPARKRSCNSQPC
SQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHALERSSPEPA
Download sequence
Identical sequences W5QI32
ENSOARP00000022383 XP_012016815.1.54773 XP_012016816.1.54773 XP_012035984.1.66739 XP_014945264.1.54773 XP_014947717.1.66739 XP_014947718.1.66739 XP_014947719.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]