SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022485 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000022485
Domain Number - Region: 204-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0549
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022485   Gene: ENSOARG00000020925   Transcript: ENSOART00000022795
Sequence length 350
Comment pep:known_by_projection chromosome:Oar_v3.1:1:99892444:99894392:1 gene:ENSOARG00000020925 transcript:ENSOART00000022795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAAGALLWALLLSLGPRAAGAEGLTSTAMPRDSFRFGGPMTRSYRTTARTTPGVVSPR
MRVTMEDEDDIVAAADSLAGPAAAELLASTVATGSRSRLSQEEDGSLEEGVVIYARKNDT
ESETDSTTRFTPGMPSPYLTANDQDFGKMSSSLPHSTWKANVDSQPSDSTANPWSSAGST
LNQWPPPSPSAMPAPEDLRLILLPWGPWHCHCKSGTMSRTRAGRLHGLSGRLRVGALSQL
RTEHRPCTYHLCPCNREREECPLDAGLCADTRCTTQTTTQTTTRAITTTTTAPFPPLTSR
LRPAPFIPSPIPSPHPAYAFWKRVRIGLEDIWNNLSTMFTEMEPIKRNQR
Download sequence
Identical sequences W5QID3
ENSOARP00000022485 XP_012036289.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]