SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022666 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022666
Domain Number 1 Region: 587-653
Classification Level Classification E-value
Superfamily F-box domain 0.000000327
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022666   Gene: ENSOARG00000021091   Transcript: ENSOART00000022978
Sequence length 725
Comment pep:known_by_projection chromosome:Oar_v3.1:7:64726604:64743813:1 gene:ENSOARG00000021091 transcript:ENSOART00000022978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWHNFSCGRTSVMHLKPYWKLQKKGQPLEIGTGTLRIPMSHQRAISDKECKARRMKSSVF
PSASLGKASSRKPFGILSPNVLCSMSGKSPEESSLNVKTKKNAPSATIHQGEEGEGPLDI
WAVVKPGNTKEKIAFFAAHQCSNRIGSMKIKSSWDIDGRATKRRKKSGDLKKAKIQLERM
KEVNSRCYQPEPFACGIEHCSVHYVSDGGDGVYAGRPLSVIQMVAFLEQRASTLLASCAK
NCTNSPAVVRFSGQSRGAPPSPEPLSAPGACEEPAERRNPEVGEPQSEPVRVLDMVARLE
SECLKRQSQREPGSLSRNNSFRRNVGRVLLVNGTQAEEGKADKGALEVPDTQVKTVGSVS
VGCSPLRADLCSPQGAQAWDGAPRGCPSVPAGVSLHTDSAEFQPDQQTAMKSSNRHDVEM
TEELVGPPFPPLTCPQAIELPTDAVDGISEELVPLANQNSDQRKKESLCISITVSKVEKD
QPSSSESCEDPLPGMLFFLPSGQHQAGHSQSDESTTEESSEASQLEEAAEGDGASEEKSI
SVDSFVPLASPVESTLPMLEASSWKKQVSHDFLETRFKIQQLLEPQQYMAFLPHHIMVKI
FRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRDPRYREDPCKQCKKKYVKGDVSL
CRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGLHDNRWVPACHSFNRAIHKKAKGTD
TEEEY
Download sequence
Identical sequences W5QIW4
ENSOARP00000022666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]