SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022667 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022667
Domain Number 1 Region: 443-509
Classification Level Classification E-value
Superfamily F-box domain 0.000000235
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022667   Gene: ENSOARG00000021091   Transcript: ENSOART00000022979
Sequence length 575
Comment pep:known_by_projection chromosome:Oar_v3.1:7:64741816:64743792:1 gene:ENSOARG00000021091 transcript:ENSOART00000022979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSASLGKASSRKPFGILSPNVLCSMSGKSPEESSLNVKTKKNAPSATIHQGEEGEGPLDI
WAVVKPGNTKEKIAFFAAHQCSNRIGSMKIKSSWDIDGRATKRRKKSGDLKKAKPEPFAC
GIEHCSVHYVSDGGDGVYAGRPLSVIQMVAFLEQRASTLLASCAKNCTNSPAVVRFSGQS
RGAPPSPEPLSAPGACEEPAERVARLESECLKRQSQREPGSLSRNNSFRRNVGRVLLVPD
TQVKTVGSVSVGCSPLRADLCSPQGAQAWDGAPRGCPSVPAGVSLHTDSAEFQPDQQTAM
KSSNRHDVEMTEELVGPPFPPLTCPQAIELPTDAVDGISEELVPLANQNSDQRKKESLCI
SITVSKESCEDPLPGMLFFLPSEAAEGDGASEEKSISVDSFVPLASPVESTLPMLEASSW
KKQVSHDFLETRFKIQQLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIE
YYNIRPADSRWVRDPRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHR
SQKGFPGCKLGLHDNRWVPACHSFNRAIHKKAKGT
Download sequence
Identical sequences W5QIW5
ENSOARP00000022667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]