SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022772 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022772
Domain Number 1 Region: 18-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000085
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022772   Gene: ENSOARG00000021187   Transcript: ENSOART00000023086
Sequence length 279
Comment pep:known_by_projection chromosome:Oar_v3.1:7:78372347:78379479:1 gene:ENSOARG00000021187 transcript:ENSOART00000023086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTLRYRLPSPLFRGSSAVCSLPPEPENGGYICHPRPCRDPLNSGSVIEYLCAEGYMLKGD
YKYLTCKNGEWKPAMEISCRLNEDKDTHASLGVPTLSIVASTASSVALILLLVVLFVLLQ
PKLKSFHHSRCRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLS
EGSGPSGRSGPREPHLQDQGACSSAGSEEEAPGQSGLCEAWGSRGSETVMVHQATTSSWV
AGSGNSRVAHKEAPDSENSDIQSLTSEDYRDDIPLLKEA
Download sequence
Identical sequences W5QJ70
ENSOARP00000022772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]