SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000165 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000165
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 6.67e-29
Family ENV polyprotein, receptor-binding domain 0.00048
Further Details:      
 
Domain Number 2 Region: 422-473
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000189
Family Virus ectodomain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000165   Gene: ENSOARG00000000188   Transcript: ENSOART00000000191
Sequence length 473
Comment pep:novel scaffold:Oar_v3.1:JH924532.1:7958:9393:-1 gene:ENSOARG00000000188 transcript:ENSOART00000000191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASVNPHQPVKITWKLQNGLTREMLNSTTAIHPPNTWWPDLYFDLKPVVNVPWKRGYLRN
HAFWACPGAPRHNWKICGGIQDSYCKSWDCVTSNDGSETPGYRRWDVGNRDLLNFSFVGP
VPPYSDWEKDHNFAQVKIRFNIDKAKKEKAWVNGISWGLQTRNDLTTYNGIIVVSQVLEP
VQMYSIGPNPVEQVHVTPYPTTSLPTSQRPTKDPEAGPLVKLGHTDPLWKLVKAAYATLN
QTHPEATKSCYLIPPYYEAIGLNASYDLANGTDPPQCRWGDRKVGLTMREVWGKGLCMGK
VLSGRSPLCAQVIEPTDLPIARWLIPQMGGWWVCSGLTPWLHSSIFDPKEEFCVMVAVVP
KILYRPEETIYDYWAQRLTLSSQEGTYRVKREPITALTIATMFGLGIAEARTGITALSLQ
SQGFNSLRAAIDEDITRIEQSISHLESSLTSLSEVVLQNRRGLDLLFLQQGGL
Download sequence
Identical sequences W5NPS5
ENSOARP00000000165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]