SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000487 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000487
Domain Number 1 Region: 360-413
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000889
Family Virus ectodomain 0.00056
Further Details:      
 
Domain Number 2 Region: 2-130
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 0.0000000000000209
Family ENV polyprotein, receptor-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000487   Gene: ENSOARG00000000487   Transcript: ENSOART00000000515
Sequence length 413
Comment pep:novel chromosome:Oar_v3.1:26:29188743:29190017:-1 gene:ENSOARG00000000487 transcript:ENSOART00000000515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAFWACPGAPRHNWKICGGIQDSYCKSWDCVTSNDGSETPGYRRWDVGNRDLLNFSFVGP
VPPYSDWEKDHNFAQVKIRFNIDKAKKEKAWVNGISWGLQTRHDLTTYNGIIVVSQVLEL
VQIYSIGPNPLNRSMQLSTQQPPYLHPRDQQKTQRLGQTDPLWKLVKAAYATLNQTHPEA
TKSCWLCYNLIPPYYEAVGLNASYDLANGTDPPQCRWGERKVGLTMREVWGKGLCMGKVP
PDRSSLCALTVELMSLPVARWSVPQMGGWWVCSHTGLTPCVHSSIFDPKKEFCVMVAVIP
KILYRPEEAVYDYWAHKLTLNQQERAYKVKREPITAITIATMFGLGIAGAGTGITALSMQ
SQGFNSLRAAIDEDSYSIEQSISHLESSLTSLSEVVLQNRRGLDLLFLQQGGL
Download sequence
Identical sequences W5NQP7
ENSOARP00000000487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]