SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000490 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000490
Domain Number 1 Region: 262-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 115-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 78-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000139
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000490   Gene: ENSOARG00000000486   Transcript: ENSOART00000000518
Sequence length 465
Comment pep:known_by_projection chromosome:Oar_v3.1:X:35498168:35593792:-1 gene:ENSOARG00000000486 transcript:ENSOART00000000518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVPAGKCVIRVLLIQQSVIRRERREGEISNVGSGDSPLEDDEVVYSDAKYKDIPWCSP
IKVKYGDVYCRAPQGGYYQTTLGTRCDIRCQKGYELQGSPQVICQSNKRWSDKVICKQKR
CPTLAMPVNGGFKCIDGAYFNSQCEYYCSPGYTLKGEQTVRCMDNKAWSGQPATCVDLEP
PRIKCPSVKERVAEPNKLTVRVSWETPEGRDTADGILTDVILKGPPPGSHFPEGDHKIQY
TVYDRAENKGTCQFRVKVRVRRCGKLHAPENGYMKCSSDGDNYGAVCEFSCIGGYELQGS
SARVCQSNLAWSGTEPSCTAMNVNVGVRTAAALLDQFYEKRRLFIVSTPTARNLLYRLQL
GMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKVMPPALALQLRLLLRIPLYSFSIVVL
DKHGVDKERYVSLVTPVALFNLIDTFPLRKEEMVLQAEMGQTCNT
Download sequence
Identical sequences W5NQQ0
ENSOARP00000000490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]