SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001017 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001017
Domain Number 1 Region: 3967-4013
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000025
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 2 Region: 2730-2955
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000112
Family Extended AAA-ATPase domain 0.038
Further Details:      
 
Domain Number 3 Region: 2374-2499,2541-2618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000371
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000001017
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0288
Family NOB1 zinc finger-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001017   Gene: ENSOARG00000000942   Transcript: ENSOART00000001051
Sequence length 5176
Comment pep:known_by_projection chromosome:Oar_v3.1:11:51264706:51387904:-1 gene:ENSOARG00000000942 transcript:ENSOART00000001051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECPSCRHVSKEEAPKFCSECGQRLLPAAPEGVPGSQSNLKETSAPEGEMECGQELREES
SSSLSLGSGDWQEDPDEPHSNASWQTKRSKRRRRSKRKKRNCKDAATSAELDSLSSSSLE
PCSLSSLADSGLQDTAPCQSPTQQDSPTHQPGEPPSVGKIPLEAVGHPLQGEAAGEAEAA
MGTESLSSPAPQDQTLGGALPGEDLPTSASEGSPKEKDTAQELLLPEPKADTSKPRKELQ
TTGQLARAPASGESDAAAEPAGSVEGAEKDVKDRTEETKEPPTSVPASRDHRQEQEIATK
DQTAVPGGKTGDNEKAKPKNLKKPEGNNGNNAAPVKNEKEQRNQSTQRAKESVLSSPEGI
MVYFHAIISKDFGFNPDQHKVYVRGGKELGKPAWNHNVCEMHYSKDLHENGSLIEGSTTI
SKQHVDKPIPYKYVICRGKNSVEYEFIYKEQAKKGEHVNRCLRVKSSLLHSGDWHQYDDI
ICMKSPGTVQRLVDCVTDGTRRQLVKGKEISAAIMLDRIFSILETWNAINLKNFFTQFEQ
FYSVIRVPMIYEGEEQPWIALQYEEKDQVRKHLWECLTKKMAPFLDTSGDPLPEGCPVKS
KLRMGMIVLLLVEKFNFLLLGKDLVSLCHLLHSDARSSDAFCRDLKHIFEPSQSWRASLV
NLCQMCMDKKVDSWVCALPVLHHCMDLSLPAQGLVMQPEDTWAALEGISFSEFRETRPDQ
KQLLELMEKNIYLLNVDKYLFRSWFSLLPLSNLAPYMEHLINYLSQCPLRVLDCLLGTWY
RLDGLQEISQENLESIKNTFNMLLYLLYIYQEKILEEPLIQSYLTVCLKLHETTCRISKA
HTFYEMPALSAEIVCRIIILKPVVDSAGGPGNETGKNSVKTVFQGTLAATKSWLRKIFKM
RMFWAGSPVVTFAYSKEIEVWRRLVEINFPMEYDWKESLLGDMAGRLKQEKPLSQISAFC
NFNWDATSAEDSVAKCFEKCAIEAVGSVCQPQTSILGQISYNDLQKCGKLVSAVITKSWP
ISREDLGGVLKHLLTWPDIKHLFKLYGTNEKILANITKEGKKLMATADSVFTEVTNDLIS
GTIVVGHLELILEHMDQFLYIWQLKSESSLAQDKNHHLRNVLSQRKNELFTLKKEKTNVD
SLLKLCERVKDVIKVLKVDFGEIAERHSEDLSGKKLNQVVTVTLSATSLDSTWTTHYNLS
PEVQEMAKNAYLLKDSHIFQIFWAEAAQELSEPEDNLEREIFQPEKVYEYLYCPCFKRFT
KLYQDLKSGEVTFGEIDDIFKDFVNKYSDLTEDLQTMCALYPRDQKDWIKGRVQQIKEYH
HLHQAVDSAKVILEVKENLGLTGDFSVLHTLLSFTVLDNFRHKKLDHINQQIIRAKKLLQ
DIDETRCQCLKELSQRKEFTSWVQEALRGTTELKVFVDLASISAGENDIDVDRVACFHDA
VQGYAPLLYELDTSAGFDEFMQHLKELWKALDNDHNLPTKLRDSARNLEWLKTVKESHGS
VELSSLSLATAINSRGIYVIKAPTDGQKISPDTVLRLILPEGQGDHKEKRDYSLEELKEL
LNKLMLMSGTKEHSNAEVVEVFSEVFCNVQRLVQSFINLYSAGNMLFRAWSAKVYCTPIN
GASIQLDFCLRLVGPLVEGGPVVQLLEALCRQLEDFLGCWERFVAEKRAEHFYLNYYTAE
QLVYLGLELGSQRPSNAALTMLSFIKGNCTPWDVSRACRGPSGMANTHQESTAVEDLVLL
LFSESRLVDKLRAIMELSMKHMRVFMPHCLDLEALGRCLAHLARMAGPPVQRELSHGLQE
GQPNLVVCGHSEVLPAALAIYMQTPHQPLPTYDEVLLCTPETTFEEVALLLRRCLTPGSQ
GLRVYSLLYADQLSYEVACRAEALFRRLCTQPHREHYRLVMVCDCEREHCYLPSAFSQHK
VLVTPQAPLKDIQAYLAHHFRVPEETLSAAAVFQDRMCVGIVASERAGVGRSLFVKRLQD
QLKIQFNGPKVPLKVIRLIDPQVDENEVLRSLLPFLDATYQRRPIIFHFDMTSSVRTGIW
VFLFKLLVLQYLMDINGKMWLRNPCHLYIIEILERNSTLPRRPSKLNALVPQFNFLDVFP
KVTCKPPKEVINMELGPQQSYKEPGMDLRAFCSETFQRPYQYLRRFHQKENLDTFQYRKG
SVEGSPGECIQHLLIYCGVINPSWSELWNFAQFLNYQLRDCEASLFCDPTFVGDTLMGFK
NFVVTFMIFMARDFATPTLHTSDQSPGKYTFTMDGVKEEDLAPFSLRKRWESEPHPYVFF
NSDHTSMTFIGFHFRSNQNGGVDAIDRLSGKVIKKDVMTEQLYQGLLLQRVPFNVDFDQL
PRHEKLEKLCLALGIQWATDPDETYELTTDNMLKILAIEMRFRCGIPVIIMGETGCGKTR
LIKFLSDLRRGGADAETMKLVKVHGGTTADMIYSKVRDAEELACFNKAQYQLDTILFFDE
ANTTEAISCIKEVLCDHTVGGQPLAKNSGLHIIAACNPYRKHTQKMICRLESAGLGYRVS
AEETTERLGSIPLRQLVYRVHALPPSLIPLVWDFGQLNDSAEKLYIHQIVQRLVKSIRMV
QSETHVITEVLSASQGFMRKRQNECSFVSLRDVERCVKVFKWFYDHSEMLLSKLDSFLSK
TGVIQNDFERDPVLWSLVLAIGVCYHASLEKKESYRKAICKFFPAPYNDSRVILDEITLT
QDLFLNDVSLRKTIARNLALKENVFMMVICIELKIPLFLVGKPGSSKSLAKTIVADAMQG
QAAHSDLFRHLKEVHLVSFQCSPHSTPQGIIGTFKQCARFQQGKDLEQYVSVVVLDEVGL
AEDSPKMPLKALHPLLEDGCIEDDPAPHKKVGFIGISNWALDPAKMNRGIFVSRGSPNER
ELIESAKGICASERLVQEKIQGYFTSFAKAYETVCKRQDKEFFGLRDYYSLIKMVFAAAK
ASNKEPSPQDIAQAVLRNFSGKDDIHALDIFSANLPEAKYTEEVSTMQLIHQNIYGHLQK
MHGRELDDSESRYLLVLTRNYVALRILQQTFFKTDQPEIIFGSSFPKDQEYTQICRNINR
VKICMETGKMVVLLNLQNLYESLYDALNQYYVYLGGQKYVDLGLGTHRVKCRVHPDFRLI
VIEEKDVVYKHFPIPLINRLEKHYLDINTVLEKWQKNIVEELKVWVEKFIDVKAEQFLAR
PKYSPSDVFIGYHSDTCASVVLQVIEQLGHEALTGERYQKVSEQAKSVLLDCATPDAVVR
LNASALGQFTAQSLSEEYYYRQQHNSFADLLQAHLRTMDSERHAIFTEITTFSRLLTSHD
CELLESEVKDWAVKLTVLSLQQFDTEYSFLKEVRNCLAHTASCKILVIQTDFEDGSQSAQ
LIASAKYSAMNEINKIQGNKNYILVNFITKLSRMGSGTSYVGFHGGLWHSVHIDDLRRST
VMVSDITKLQDVAISQLFKPEDPAKVEVGRRAQEDDEEVMETEAVTSQQVAEVKMETVSP
EHSGSQGNLTRACGGNLMQILDTTRLLKSCIQGAVGMLRDQNEDCQRSVQRVSILLSLLD
ENSEYRATFLLVAKMRLYVLLMKQEENAICNVKDWVVREASNQDALQEAGTFRQTLWKRV
QGAVTPLLASVISCVDRDGNLDLLVNPHCPSWARELWMFIFNDVKLLNIPLVTIDTRSKG
EMSYIVVQNYINLPEKASNSVPFSWRIKDYLEELWVHTQYITENAGLAKKLLELFQKTPL
GSFLAQLTVDQRQELLQCYLKDFLLLTMRVSTWEQLNVLQMALWSCINQLNAGMPEKEVS
LPLVHLAYHRFRNRLQNFSRILTIHPPILLSLTKGTENHNWARHEMSLDVLAAVACAEML
TENLLKPSPQAWLQTVKNLSMPLELLCSEGYMQDCGMMTRTLIRDIRTDWNRIFSISLFV
EHVLLETESQIPELRELVTDYVSLLNKCLLENSDMKTHRPFMAVMTTLRKCKDQVSESFT
RFGVQPCPICLGDAQDPVCLPCDHVFCLRCIQVNLTQGHMGCPLCLTDLPDRYSPTVSQE
HREVIEKHARFRQMCNSFFVDLVTTMCFKDNSPPQKEVVKDLLSLLFVEKELLREAPQRR
REHTKSLSPFDDVVDKTPVIRSVVLKLLLKYSFCDVKEYIQTYLSELEKKPFLAEDKTEL
YMLFSNCLEDSIHEKNNAFFIRDELKYLQEEGQFLTTYPRVGYSRWPAGEASVEHLQEMA
RIRLCLDKASEILAELQDGSEMAEEKRRYLKQVERFCARVQNDWYRVYLVRKLTSQQGME
FVQSLSKEGHPAHWVFPKEVIAQQELQRDHPGQMDRYLVHGNDYKAVRDAVAKAILESKP
LAIETALEACRSSTTQEAVYLLLALFREVTTLYRSHNADLHPKPQQCEAMKKFIEKSNTL
SPDIRAFAMSLVNNELPLLRTGPGVSNLEGTVIEMAVHAATVLLCGRSQVLGPLKNLAFF
PHLMVNAFLPTMPEDLLPQARNWKGLEGVKWYTCPNGHVCSVGECGRPMVKSLCIDCRAP
IGGINHKPEKGFHVINDTTDRTQTGHVLGNPPPRGVPVVSDRQMSPVVFLLIRLLTHLAM
LLGATQSPQDLMNIIKPLVWDPKGFLQQHIQRDLEQLKNTLGRSADETASVVHLVLCRLL
REQGHSFSFKRSFNFVAELSTREERNRWEKLVETIILHELEHLDKTLLAVNAQISQDERI
SSNPVAKIVYGDPVTFLPRLPKNSMVHCSKMWSCRKRISIEYLQHIVEQKNGKESVPILW
KFLQKEAELRLVKFLPEILALQRNLVKRFQNVSEAEYRSIQSFISSHDSDGLKKLACSRI
TIFLSTWNKLRRSLETNGEIKLPKDYCSSDLDLDTDLEVILPRRQGRGLCSTALVSYLIN
LHNDIVYAVEKFSKEDNSYSVDASEIADLHVISYEVERDLIPLILSNCQYHVEQGGKTLQ
EFDLEKIQRQIVSRFLQGKPRLTLKGLPTLVYRRDWNYEHLFMDIKNKMPQCPLPNVAIT
AIRGQLQSYSDACEALSAIEVTLGFLSTAGGDPDMHLNVYIQDMLKMGDPTSLVSKALSR
CQLKHTIALWQFLSAHKSEQLLRLGKEPFGEIIPRYKADLSPENAKLLNTFLNQIGLDAF
LLELHEMMILKLKNPKIAESFNPEWSLRDTLVSYMETKDSEIPPEMESQFPEEILLSSCV
AVWKMAAELKRNRQMR
Download sequence
Identical sequences W5NS77
ENSOARP00000001017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]