SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001189 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001189
Domain Number 1 Region: 35-87
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000824
Family WD40-repeat 0.0045
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily F-box domain 0.0000196
Family F-box domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001189   Gene: ENSOARG00000001147   Transcript: ENSOART00000001225
Sequence length 87
Comment pep:known_by_projection scaffold:Oar_v3.1:JH921621.1:279:668:-1 gene:ENSOARG00000001147 transcript:ENSOART00000001225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRQWQAVSRDEFLWREQFYRYFQVARDVPRHPAATSWFEEFRRLYDAVPCVEVQTLREH
TDQVLHLSFSHSGYQFASCSKDCTVKV
Download sequence
Identical sequences W5NSP9
ENSOARP00000001189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]