SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001635 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001635
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-23
Family Pyrin domain, PYD 0.0031
Further Details:      
 
Domain Number 2 Region: 439-504
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 668-825
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000226
Family SPRY domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000001635
Domain Number - Region: 368-421
Classification Level Classification E-value
Superfamily RING/U-box 0.0043
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001635   Gene: ENSOARG00000001557   Transcript: ENSOART00000001678
Sequence length 831
Comment pep:known_by_projection chromosome:Oar_v3.1:24:2688538:2700937:-1 gene:ENSOARG00000001557 transcript:ENSOART00000001678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRTRSDHLLYSLEELLPYDFEKFKFKLQNTSLEKEHTRIPRGQLQTAEPVKLASLLVNH
YGEEYAVQLTLQVLRAINQHLLAEELHQLISPVCRIQEGDTDSSATSGSSGEMKPKSLKT
LDGLEGDKQRQSADGAGCPSSSQPEAGRGSQKKPLGKQRDQKGPEGLEVQSKLGARNTTL
SSKRSPFLGKVLREKEKGSCPSVRLRRNASSAGRLQGLTSGSLAGSPGRRETKISEVYLP
SGKKRPKSLEFTISPEETGPLNPEILLLQEKMNTENPSSATTASEVATLKTGPTVTLEKG
SRNPEHATTLEGTALRNTPFSVPLAGKTMIGEHLEPKAPAERSGTGAPKASSVPHEPSDP
EVSPSSGRLQDKAVCPLCRAQEGDPAGGSCVHISCSCSSASGDPEASLSRSSSCPRCQDL
LPGKGHGSREWQEGLQMASLNPKSLPQCERHMKQAQLLFCEDHGELICLICRLSQEHRGH
RVRPIEEAALEYKEQIQKQLDHLKELRKSGEEQRSQEDKKTVNSLKQAETQKQRIQYQLE
QLCQFLEQQERLFVAWLEELGQTIGQVRETYGTRGTRDIALLDELIGELEAKQCQPEWEL
MKDIGVTLHRAKMVTVPELWATPPEVKEKIHLLYQKSAFVEKRVKHFLETLRSEVETFNV
AELIGGILILSAVNVILEAETVHSNLIFSNDMKSVSLGENKWDHLPASPGKFNREVKVGD
KPGWVLGVCNAATSSKENMTVSPENGHLVETMSMHLSPDPDGEACWHRGISADYKMGTSP
FTMGQPNPTSLTATGYLPPEPLQPILSPRTHDGEKNMDPLTICPVGVATAS
Download sequence
Identical sequences W5NTZ1
ENSOARP00000001635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]