SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001757 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001757
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000000719
Family Regulator of chromosome condensation RCC1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001757   Gene: ENSOARG00000001673   Transcript: ENSOART00000001800
Sequence length 119
Comment pep:novel chromosome:Oar_v3.1:15:34305231:34305711:1 gene:ENSOARG00000001673 transcript:ENSOART00000001800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSVSGGVCHSWGWNEHGMCGDGTEADVWAPKPVPGLPSSLGLHVGCGAGHSLALCQLPA
LPDLGQHPRVTSPSPDAIEEARSQVAMEQERNQKERHAETSPQAQSDRFRNGGLVAETL
Download sequence
Identical sequences W5NUB3
ENSOARP00000001757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]