SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002362 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002362
Domain Number 1 Region: 74-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-80
Family Protein kinases, catalytic subunit 0.00000212
Further Details:      
 
Domain Number 2 Region: 994-1053
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000987
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1069-1189
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000352
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 4 Region: 1221-1473
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000288
Family Tricorn protease domain 2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002362   Gene: ENSOARG00000002215   Transcript: ENSOART00000002413
Sequence length 1719
Comment pep:known_by_projection chromosome:Oar_v3.1:12:28131723:28425668:-1 gene:ENSOARG00000002215 transcript:ENSOART00000002413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPPQVSDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFNGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPTPLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTADGP
LTASKDLEIKSLKEEIEKLRKQVRESSHLEQQLEEANSVRRELDDAFRQIKAYEKQIKTL
QQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVRTEAVAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGQQLALNKEIMILKDKLEKNRRESQSEREEFENEFKQQYEREKVLLTEENKKLT
SELDKLTALCENLSARNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFETVDSTPLPVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLM
VGLIRQGCSCEVCGFSCHITCVNKAPTACPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPK
PAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPSVVVSQVIDMRDEEFSVSSVLASDVIH
ASRKDIPCIFRVTASQLSASSNKCSILMLADSENEKSKWVGVLSELHKILKKNKFRDRSV
YVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIEL
IPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLAETKGCQTITSGKVHHGALTCLCVA
MKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGSPYS
MLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPS
SCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNSEGSLNLLGLETIRLIYFKN
KMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISN
PTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTAFSGSVSIPSITKSRPEPGRSMSASSG
LSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDYDGEDSDS
PRHSTASNSSNLSSPPSPVSPRKTKSLSLESTDRGSWDP
Download sequence
Identical sequences W5NW15
ENSOARP00000002362 XP_004013688.1.66739 XP_011973855.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]