SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002641 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002641
Domain Number 1 Region: 145-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000957
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 24-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000459
Family Complement control module/SCR domain 0.0000821
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000958
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002641   Gene: ENSOARG00000002493   Transcript: ENSOART00000002694
Sequence length 212
Comment pep:novel scaffold:Oar_v3.1:JH922656.1:15039:19249:-1 gene:ENSOARG00000002493 transcript:ENSOART00000002694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILKIIFVLYSLTSVLHIEKIGCSQPPQIDHGTVNSSSSAEERREIHEQKLYAHGTKLS
YTCEEGFEISENNVIICHMGKWSSPPQCVGTNCVNLPTFDDAVLIDREKDSYKSGEQVAF
KCLSYYQLDGANTIQCIKGKWIGRPACRDVSCVNPPQVENAIIQNQKSRYQSGERARYEC
IGNYDLFGEIDVVCLNGTWTKPPQCKGRVSYS
Download sequence
Identical sequences W5NWU4
ENSOARP00000002641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]