SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002711 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002711
Domain Number 1 Region: 541-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 101-161
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-25
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 653-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 597-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 694-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 724-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000233
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002711
Domain Number - Region: 302-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000224
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 231-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00619
Family Classic zinc finger, C2H2 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002711   Gene: ENSOARG00000002550   Transcript: ENSOART00000002764
Sequence length 792
Comment pep:known_by_projection chromosome:Oar_v3.1:24:38382711:38394470:-1 gene:ENSOARG00000002550 transcript:ENSOART00000002764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEVYFSRIRCSSTDEKVFSRSKVIMWELQACECVLSLCSSKPCWKVEGSVSHKCLVKCW
AGLVHTSSSWVASLPAFPPSGPPLLSQSCRLFREQRKMNQSLGSVSFRDVAVDFTQEEWQ
HLDPEQKTTYRDVMLENYSHFISVGCHIIKPEVITKLEQGEEPWVVEGEFLLQSHSEVWK
VHDLMEGSQENEDKHSRQTESINIKTLPEGRGNGLGKTCNVQTSPVPSRKRSYQCDSCEK
SLKSISEYISSDGSYARMKPDECCACGRSLLHVKLEKTHLGDKPYEFNQNREAYALNGES
IYQNIHILEKPFEYIECQKAFQKDTVFVNHIEEKPYKWNESEIAFLQMSNLSVHPTTHLE
MKPYECNACGKSFCKKSKFIIHQRTHTGEKPYECNQCGKSFCQKGTLTVHQRTHTGEKPY
ECTECGKTFYQKLHLIQHQRTHSGEKPYECSYCGKAFCQKTHLTQHQRTHSGERPYVCHD
CGKTFSQKSALNDHQKIHTGVKLYKCNECGKCFCRKSTLTTHQRTHTGEKPYECNECGKF
FSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMRHQRVHTGEKPYECNECGKLFSQL
SYLTIHHRTHSGVKPYECNECGKTFYQNSALCRHRRIHKGEKPYECYICGKFFSQMSYLT
IHHRIHSGEKPYECNECGKTFCQNSALNRHQRTHTGEKAYECYECGKFFSQMSYLTIHHR
IHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYECTECGKKFYHKSAFNSHQRIHRR
GNMNVLDVGRLL
Download sequence
Identical sequences W5NX14
XP_014959303.1.66739 ENSOARP00000002711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]