SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002714 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002714
Domain Number 1 Region: 45-240
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 2.35e-33
Family ENV polyprotein, receptor-binding domain 0.00029
Further Details:      
 
Domain Number 2 Region: 439-478
Classification Level Classification E-value
Superfamily Virus ectodomain 0.000000322
Family Virus ectodomain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002714   Gene: ENSOARG00000002556   Transcript: ENSOART00000002768
Sequence length 478
Comment pep:novel chromosome:Oar_v3.1:12:1450943:1452522:1 gene:ENSOARG00000002556 transcript:ENSOART00000002768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDTASLQSSKNETHPSGPGRIALILLMVAVLFDPGTANSNPQQPARITWTLRNGLTHE
VLNLTTGIHPPNTWWPDMYFSLKDLIKTTWTAAQTRNFGFWACPGHLKKHNWETCGGPQH
YFCWSWSCVTSNDGRWKWEVGNRDLVNFSFVQPYRGPWDQDYQDLLGNYVGPRWKQHWDP
IAQVKVMFNQKSAKLERSWVSGLTWGLQLYAEWFESKPGGILVISQTIEPIQSQGVGPNQ
VENPGPQQVIKAHPTQGAATLSPMPSVSRPGDLVKAAFAALNHSNPGATQSYWLCYTLYP
PFYEAIGLNVSYNLSISTNPPQCHWGECRVGLTMGRGLCLGTVPPEKTSLCAQTADLTRL
DKTKWIVPEPGGWWVCSHTRLTPCLRASVFNQSREFCILVAVMPKILYHPEEAITLATIF
SLGIAGTGTGIAALSLQGQGFTSLRAAVDEDSTRITESISHLEKSLTSLSEVVLQNRR
Download sequence
Identical sequences W5NX17
ENSOARP00000002714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]