SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003143 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003143
Domain Number 1 Region: 957-1238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-59
Family Eukaryotic proteases 0.000000000949
Further Details:      
 
Domain Number 2 Region: 685-954
Classification Level Classification E-value
Superfamily vWA-like 2.82e-54
Family Integrin A (or I) domain 0.0000000225
Further Details:      
 
Domain Number 3 Region: 302-505
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-32
Family Eukaryotic proteases 0.0015
Further Details:      
 
Domain Number 4 Region: 126-302
Classification Level Classification E-value
Superfamily vWA-like 3.86e-24
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 647-703
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0000361
Further Details:      
 
Domain Number 6 Region: 580-641
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0000436
Further Details:      
 
Domain Number 7 Region: 88-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 8 Region: 22-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000117
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 527-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000639
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003143   Gene: ENSOARG00000002951   Transcript: ENSOART00000003203
Sequence length 1244
Comment pep:novel chromosome:Oar_v3.1:20:26543679:26561667:-1 gene:ENSOARG00000002951 transcript:ENSOART00000003203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMAVLCLLPLYPGLATAALSCPKNVNISGGSFTLSNGWSPGSILTYSCPLGRYPYPV
ATRLCKSNGQWQIPRSTRLTKAICKPSHCPNPGISVGAVRTGSRFGLGDKVRYRCSSNLV
LTGSAERECQDDGVWSGTEAICRQPYSYDFPEDVAPALGTSFSHLLATTNPIQQKKNHEN
GTGTNIYEALHAVYIMMNNQMNRLRMNPVAWQEIRHAIILLTDGKSNMGGSPKVAVDNIK
EVLNINQKRKDFLDIYAIGVGSLQVDWKELNNLGSKKDGERHAFILKDVQALSQVFEHML
DISQLTDPICGVGNMSANASAQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCLSNAE
DRTLWRVSVGDPNFQGSKEFQIEKAEGDDIALLKLTQKVKMSTHARPICLPCTVGANLAL
RRLPGSTCRDHEKELLNQVSIPAHFVALNGDKLNINLKTGSEWTNCVKVVSKDKTTFPNL
TDVREVVTDQFLCSGTQGDDSPCKGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQV
LEYLCPSGFYPYPVQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPR
AAYYNLSDEISFRCYDGYTFRGSANRTCLGNGRWDGETAICDDGAGYCPNPGIPLGTRKV
GSQYRLEDRVTYYCNRGLTLRGSQQRTCQEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSS
LTETIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFI
EKVASYGVKPKYGLVTYATEPKVLIKVFDPKSSEADWVTEQLNRINYADHKLKAGTNTKR
ALLEVYNMMSRDINNLKETWNRTRHVIIIMTDGLHNMGGDPVTVIHDIRYLLDIGRNRKN
PREDYLDIYVFGVGPLVNQENINALASKKDKEQHVFKLQGMENLEDVFVQMLDESRTLGL
CGMVWEHKDGTPYHKQPWHAKISVIRPSKGHESCMGAIVSEYFVLTAAHCFTVDDEKHSI
KVSVGGKRQEWEVEEVLFHPNYNLNAKKAKGIPEFYDYDVALIKLTKKLKYETTIRPICL
PCTEGSIQALRLPRSTTCQQQMQELLPAKDIEALFVSESKKTLTRKAVYIKNGDKKASCE
RDALHAPGYDKVKDVSEVVTPRFLCTGGVAPYADPNTCKGDSGGPLIIHKRSRFIQVGVI
SWGVVDVCKRPQQVPGYARDFHINLYHVLPWLKEKLKNEDLGFL
Download sequence
Identical sequences W5NY95
ENSOARP00000003143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]