SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003363 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003363
Domain Number 1 Region: 1152-1349
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000259
Further Details:      
 
Domain Number 2 Region: 937-1060
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 45-167
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000003363
Domain Number - Region: 201-343,1848-1891
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00157
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003363   Gene: ENSOARG00000003154   Transcript: ENSOART00000003427
Sequence length 1956
Comment pep:known_by_projection chromosome:Oar_v3.1:13:24526958:24654525:-1 gene:ENSOARG00000003154 transcript:ENSOART00000003427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDVDTKLKACGSPTCEVSTSKDGKEQSETISPSEDEMFSWPGPKTVMLKR
TSQGFGFTLRHFIVYPPESAIQFSFKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTAL
AYSQDAYLKGNEAYSGNARNIPEPPPVCYPWPSSAPPAMAQPPEPPPPDSTASKPQTSPP
VLTQPGRAYRMEIQVPPSPPEVAKSNTAVCVCNESVRTVIVPSEKVVDLLPNRSNHTVPA
HRTEEVRYGRNEQPSFKTATRTTSPPSSVPTAHLIHQPGSRSLEPSGILLKSGHYGGHSE
GLVSRSPAVESPSVTVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLRA
ASQSTADYNQVVLNRAALQVRRRSTSQDRVPQSIQVRQRSVSQERLEDSVLMMYCPRSAS
QGALTSPSISFSNHRTRSWDYIEGQGETSENVHSECPPPDANGERKQTYKWSGFTEQDDR
RGIYERSRQQEIHKSFRGSNFTVAPSVVNSDSRRMSSRVGGSVSQFKKIPADLKPLQPSR
NFQTTCGMSQPRGISQDRSPLGKVRSNSLKAPSTHVPKPPSSQNSFVSIKDQRPVNHLHQ
NSLFNQQTWLRTESAPDHQVDTGKPPSLSGASVKPPALASENASTPDFELSVTQRNQDLN
VQEVEIQQSNAVDNKETVILREKPPSGRQTPQPLRHQSYILAVSDQETGSDTTCWLPNDA
RREVHIKRMEERKASSTTPPGDSLASIPFIDEPTSPSIDHDISHIPASAVISASTSQVPS
IATVPPSLTTSAPLIRRQLSHDQESVGPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSF
KHVSSLKGIKILDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRP
WKQMYVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCE
CLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEPLPKTPRQ
SLSIRQTLLGAKAEPRTQSPHSPKEESERKLLSKEKQSKDDTSPPKDKGTWRKGIPSIMR
KTFEKKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAI
SSMQEELNKGMADIDIQDDNQKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKE
DPLDRLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTS
EDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEENTVDSQPVPNIDHLLT
NIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSRDLLVSSIFAAASRKRKKPKEKAQP
SSSEDELDNVFFKKENSEQGHHDIKEESKKESETQGRKQRTVAPKENNTKKDSSGGGRAE
QRAPRGESLEPPAPQSTKQSRSPTLSCRLAVLRESPRALAAQKTSHLEDTGSDSGTPLST
RAPAPLASFPTRKPPSPEPKHSELLVSVGSITSDYAGAPSAPYLACIVYHRHCPFKVERG
DEADDERSELVSEGRPVETDSESDFPVFPALLASDRHFRGKLQEAARTSRRNSEGSEVSC
TEGSLTPSLESRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDSKNEKEAPSITKVFDV
MKKGKSTGNLLTPPARSESDKQEPTWKTKIADRLKLRPKAPADDMFGVGSQKTIPDPAKR
KNIKRRHTLGGHRDATEISVLNFWKAQEQSGDRESELSAVNRLKPKCSAQDARERLRTST
TDLSRGDTGDPQPESLGTLEIPTRDPPLSFQSDADSSSSTLASTNRAPLSTPPQSPDQIN
GESFQNTSQNSSSAATVQPHQLSETPDHKAQFHPCL
Download sequence
Identical sequences W5NYW5
ENSOARP00000003363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]